PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G138300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 330aa    MW: 36600.4 Da    PI: 9.4263
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G138300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.8e-201055147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEde l ++v+++G+++W+ I++ ++ gR++k+c++rw + 
  Aqcoe5G138300.1.p 10 KGPWSPEEDEALQQLVQKHGPRNWSVISKSIP-GRSGKSCRLRWCNQ 55
                       79******************************.***********985 PP

2Myb_DNA-binding58.61.4e-1864106347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++T+eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
  Aqcoe5G138300.1.p  64 AFTPEEDEMIIKAHAKFGNK-WATIARLLN-GRTDNAIKNHWNST 106
                        79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.028560IPR017930Myb domain
SuperFamilySSF466895.03E-337103IPR009057Homeodomain-like
SMARTSM007171.2E-17958IPR001005SANT/Myb domain
PfamPF002492.1E-191055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-261163IPR009057Homeodomain-like
CDDcd001677.16E-171254No hitNo description
SMARTSM007174.0E-1661109IPR001005SANT/Myb domain
PROSITE profilePS5129422.59962111IPR017930Myb domain
CDDcd001672.40E-1364107No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2464110IPR009057Homeodomain-like
PfamPF002497.5E-1664106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MSSKDLDRIK GPWSPEEDEA LQQLVQKHGP RNWSVISKSI PGRSGKSCRL RWCNQLSPQV  60
EHRAFTPEED EMIIKAHAKF GNKWATIARL LNGRTDNAIK NHWNSTLKRK CSSMIDEGSM  120
DGYEHHRPLK RSSSAGAAIP VSGLYLSPGS PSGSDVSDSS IHVMSSHVYR PVARAGGVLP  180
LPQVDQQIES SSSLLKDPPT LLSLSLPGIG GDSSSESLNL SKRNTTHSHR RSHTLPSVVP  240
PQFPFQQFQP SFAHQEQQLQ QQQMEVEKEK QQPEKNLMSF SPEFLTVMQE MIKKEVRNYM  300
SGLEQNGMCA QADGIRNAAV KRIGVGKME*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-40911157159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-40911157159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAPTransfer from AT5G67300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268121.11e-140sucrose responsive element binding protein
SwissprotQ9FDW13e-98MYB44_ARATH; Transcription factor MYB44
TrEMBLF6HSY71e-141F6HSY7_VITVI; Putative uncharacterized protein
STRINGVIT_07s0129g01050.t011e-141(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.18e-81myb domain protein r1